PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009794663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 602aa    MW: 65827.8 Da    PI: 4.7116
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009794663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS353.33.7e-1082346012373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      + LlecA+ +++++ e+a + L rl+e +s++gdp++R+ +yf eAL +rl+ +++++ +++ + + +     e + ++k+f++++P+ kf+hl
  XP_009794663.1 234 LKSLLECAR-LADSEPENAVKSLIRLKESVSQQGDPTERVGFYFFEALYSRLSFQTDNIPSIFGTCTPE-----ELTLSYKAFNDACPYSKFAHL 322
                     578******.566689999999********************************999999999766665.....78899**************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     taNqaIlea+e++ r+Hi+Df+i +G+QW+a+lqaLa+R++g+p s+Ri g+ s   g   + +l +tg+rL++fA+ l+++fef++ + + +++
  XP_009794663.1 323 TANQAILEATEKAMRIHIVDFGIVHGIQWAAFLQALATRSAGKPvSIRISGIPSVVLGnsPAASLLATGNRLRDFAKLLDLKFEFEP-ILTPVQE 416
                     ****************************************88777*********877788999************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ +++r++p+E+laVn++lql++llde+    +   + L+l ksl+P +v++ e e+++n+  Fl+rf++al+yys++f+sl+ +l ++s er+
  XP_009794663.1 417 LNESSFRIDPDETLAVNFMLQLYNLLDETSVGVK---TALNLAKSLNPSIVTLGEYEVSLNNVGFLQRFSNALNYYSTIFESLDPSLTQDSPERV 508
                     **************************88777666...9********************************************************* PP

            GRAS 284 kvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaW 373
                      vEr +lgr+i  +v + +a  rre +e +e+W+e +e aGFk+v+ls++a++qak ll +++ s  y + ++   ++ l W+d+pL++vS+W
  XP_009794663.1 509 QVERLILGRRIAGAVGTDEAGiRRECMEDKEHWKELMEGAGFKEVTLSHYAMSQAKILLWNYNySSSYGLIDSPPGFLsLAWNDKPLLTVSSW 601
                     ***************9999888*****************************************9999998877665555************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.271207580IPR005202Transcription factor GRAS
PfamPF035141.3E-105234601IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 602 aa     Download sequence    Send to blast
MAAYMCTDSG NLMAIAQQVI KQKQQQEQLQ QQEQQQHQQF LGGVNPLCLS PWTGTHQSLT  60
NSPTLGYGGL TGGPGFTDPF QVVAGGTDGG EPGFQFPNLE HHSTGFRFTD FSGGPGGEFD  120
SDEWMESLIG GGDSTGSSNL QSSSYAWHTS SEFAALYGDP FSSCPNRLSI ASSPPPPTSD  180
LNGVIFSETQ KNLNPLQPWV PPSSSPPVVH KESKVASGDV HCSSPETFSS KPLLKSLLEC  240
ARLADSEPEN AVKSLIRLKE SVSQQGDPTE RVGFYFFEAL YSRLSFQTDN IPSIFGTCTP  300
EELTLSYKAF NDACPYSKFA HLTANQAILE ATEKAMRIHI VDFGIVHGIQ WAAFLQALAT  360
RSAGKPVSIR ISGIPSVVLG NSPAASLLAT GNRLRDFAKL LDLKFEFEPI LTPVQELNES  420
SFRIDPDETL AVNFMLQLYN LLDETSVGVK TALNLAKSLN PSIVTLGEYE VSLNNVGFLQ  480
RFSNALNYYS TIFESLDPSL TQDSPERVQV ERLILGRRIA GAVGTDEAGI RRECMEDKEH  540
WKELMEGAGF KEVTLSHYAM SQAKILLWNY NYSSSYGLID SPPGFLSLAW NDKPLLTVSS  600
WH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1512306021375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794663.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLK4BB460.0K4BB46_SOLLC; Uncharacterized protein
STRINGSolyc02g085340.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA89052429
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein